PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG006432t1
Common NameTCM_006432
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 332aa    MW: 35892.4 Da    PI: 7.9498
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG006432t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.28.9e-14204260460
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                        +++rr++kNRe+A rsR+RK+a++ eLe  v +Le+e ++L  e  el+ke  k  
  Thecc1EG006432t1 204 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEEQTRLLREEAELQKERFKQL 260
                       689**************************************9888878877765544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-13198260No hitNo description
SMARTSM003382.5E-12201265IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.392203255IPR004827Basic-leucine zipper domain
PfamPF001703.7E-12203262IPR004827Basic-leucine zipper domain
CDDcd147078.77E-21205254No hitNo description
SuperFamilySSF579594.31E-10205257No hitNo description
PROSITE patternPS000360208223IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MASSKVITTT SATNPDVPRQ PSLCSSLSTL LADLQNQQSN QSQSQNGSMS MDDLLKNIYS  60
SPPPPPTTSE AHAQFPGASI SREGSFSLPK DVANKSVDEV WKEIVAGGGD QRQGGPTEEM  120
TLEDFLTKAG AVREEDVRGV VNQVGVGAGV YAVDPAVING GGSQFSTFGN NGGVDHQRLV  180
APAGGGARGK RRAVEEPPLD KATQQKQRRM IKNRESAARS RERKQAYTVE LESLVTQLEE  240
EQTRLLREEA ELQKERFKQL MENLIPVEEK RRPPRVLRRV HSMQCNVLTA SKLTPSTSTI  300
LTIITATVKF CSEATTSSTV GVSWLICIDG K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007041583.10.0Basic-leucine zipper transcription factor family protein, putative isoform 1
SwissprotP427772e-42GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A061DX740.0A0A061DX74_THECC; Basic-leucine zipper transcription factor family protein, putative isoform 1
STRINGVIT_12s0055g00420.t015e-91(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.19e-30bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]